Product Informations

• Product No. BA00024
• Product Name Recombinant Human RTCA Protein
• Category 392
• Gene Name RTCA
• Recommended Applications Dependent by end user
• Reactivity Human
• Storage Buffer 0.01M Phosphate buffered saline
• Predicted Molecular Weight 35kDa
• Shipping and Storage Conditions -20℃ to -80℃/1 year
• Expression System Escherichia coli
• Sequence AGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKD
• Precautions Coverage rate = actual sequence length of protein/effective length. The effective length refers to the actual length when it works in its natural state, excluding sequences such as signal peptides and precursor peptides that are cut off after maturation. It can be obtained from the Uniprot database. The actual sequence length and sequence published on the official website have been blurred. If accurate sequence information is required for the experiment, please contact us.
• Tag C-His
• Isoelectric Point (pI) 8
• Amino Acid Ala41 to Asp350
• Coverage 0.87
• Human Swissprot No. O00442
• Mouse Swissprot No. Q9D7H3

Picture

Product Details