Product Informations

• Product No. BA00008
• Product Name Recombiant Human Calprotectin (S100A8 & S100A9) Protein
• Category 392
• Gene Name S100A8 & S100A9
• Recommended Applications Dependent by end user
• Reactivity Human
• Storage Buffer 0.01M Phosphate buffered saline
• Predicted Molecular Weight 26kDa
• Shipping and Storage Conditions -20℃ to -80℃/1 year
• Expression System Escherichia coli
• Sequence (MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE) & (MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP)
• Precautions Coverage rate = actual sequence length of protein/effective length. The effective length refers to the actual length when it works in its natural state, excluding sequences such as signal peptides and precursor peptides that are cut off after maturation. It can be obtained from the Uniprot database. The actual sequence length and sequence published on the official website have been blurred. If accurate sequence information is required for the experiment, please contact us.
• Tag N-His
• Isoelectric Point (pI) 7
• Amino Acid Met1 & Met1 to Glu93 & Pro114
• Coverage 1
• Human Swissprot No. P05109 & P06702
• Mouse Swissprot No. P31725

Picture

The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained.

Product Details