Product Informations

• Product No. BA00018
• Product Name Recombinant Human IL-23 (IL23A & IL12B Heterodimer) Protein
• Category 392
• Gene Name IL23A & IL12B
• Recommended Applications Dependent by end user
• Reactivity Human
• Storage Buffer 0.01M Phosphate buffered saline
• Predicted Molecular Weight 59kDa
• Shipping and Storage Conditions -20℃ to -80℃/1 year
• Expression System HEK293
• Sequence (RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP,RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP) & (MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS,MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS)
• Precautions Coverage rate = actual sequence length of protein/effective length. The effective length refers to the actual length when it works in its natural state, excluding sequences such as signal peptides and precursor peptides that are cut off after maturation. It can be obtained from the Uniprot database. The actual sequence length and sequence published on the official website have been blurred. If accurate sequence information is required for the experiment, please contact us.
• Tag C-His
• Isoelectric Point (pI) 6
• Amino Acid Arg20 & Met1 to Pro189 & Ser328
• Coverage 1
• Human Swissprot No. Q9NPF7 & P29460
• Mouse Swissprot No. P43432

Picture

The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained.

Product Details